PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0250s0210.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 296aa    MW: 33095.5 Da    PI: 8.7774
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0250s0210.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.44.2e-403495263
                  zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                            k++al+cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  SapurV1A.0250s0210.1.p 34 KDQALNCPRCNSTNTKFCYYNNYSLSQPRYFCKNCRRYWTEGGSLRNVPVGGGSRKNKRSSS 95
                            7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-262683IPR003851Zinc finger, Dof-type
PfamPF027015.9E-343592IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4133892IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104076IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MDTATQWVQG NIGVVKPVEG PRSDVLERRA RPQKDQALNC PRCNSTNTKF CYYNNYSLSQ  60
PRYFCKNCRR YWTEGGSLRN VPVGGGSRKN KRSSSAPSTS AASSRKFPHD LTQPCFPQSA  120
SQNPKIHEGQ DLNLAYPPSA DDYSNLSNFV EIPFDSTERN KTHHQNPNPS RTSPSHHHHF  180
SHMEFLKSTA MNSRGFSSFM SIPALSDPNN TMFSTGFPIQ EFKSTQSFSL EGLENRYSNI  240
QGVHETGGSA RVLFPVEDLK QQVPSNTEFE QNITREQRDS APAGYWNGML SGGSW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002317793.21e-168hypothetical protein POPTR_0012s02570g
TrEMBLB9I1Z11e-168B9I1Z1_POPTR; Uncharacterized protein
STRINGPOPTR_0012s02570.11e-167(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-42Dof family protein